PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G457000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family GRF
Protein Properties Length: 591aa    MW: 64299.2 Da    PI: 7.234
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G457000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.11.7e-24205249145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Aqcoe5G457000.1.p 205 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEG 249
                        79****************************************985 PP

2QLQ62.98.6e-22136172137
                QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                        ++FT++Q+++L++Q+l+yKy++an+P+P++Ll +i+k
  Aqcoe5G457000.1.p 136 GPFTPSQWMELEHQALIYKYINANVPIPSNLLIPIRK 172
                        59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-12136172IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.451137172IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.4E-16137171IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.663205249IPR014977WRC domain
PfamPF088797.0E-21206248IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MDFGLVSLDS LVTSSSQSGF APLVSDSETR QQKSHGSEFL KQERSFGVDG NDWRNLKKGR  60
NDDFSTMLLL QQRERGSSSL YSDGQQQEHM LSFSSPKSDP FSVNSDYYHS AYTRNAGLGP  120
GSWNTNMHGA LTGARGPFTP SQWMELEHQA LIYKYINANV PIPSNLLIPI RKALHPSGFP  180
GFYGSFRPNA LGWGSFHLGF SGNNDPEPGR CRRTDGKKWR CSRDAVADQK YCERHMNRGR  240
HRSRKPVEGQ VGHAATGPAT TKVVSMASSP SFVASGGGAS SNLNVAQKQV KNLPPSAVDA  300
SSNLHMNRIS LNNGSAGGRL YDSQGLSMLS PATNMNSKDT SFSMLKQHIP CEESSRSEFG  360
LISSDSLLSN SQRGSYIDCR KFGRSPDLNN QEPRAQDPVR CFIDDWPKNQ SDSSMISWPG  420
IEETQGDRTQ LSISIPMSSD FSSSSPSPTH EKLALSPLRL SREFDPIEMG LGVGSFSDEP  480
TQREVNWIPI SWESSMGGPL GEVLNHTSNV SVNHKSSSST LNLMTEGWDA GLQMELSPTG  540
VLQKTSFGSL SNSSAGSSPR AEVNKTPEGE SFYDSMLGPS FMKSSSIPSL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4886161e-40AM488616.1 Vitis vinifera contig VV78X030262.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273550.10.0PREDICTED: growth-regulating factor 6-like isoform X2
TrEMBLA0A061FG660.0A0A061FG66_THECC; Growth-regulating factor 1
STRINGVIT_18s0001g08650.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.17e-99growth-regulating factor 1